Yahoo Web Search

Search results

1. Dictionary

   for·ward

   /ˈfôrwərd/

   adverb

   • 1. in the direction that one is facing or traveling; toward the front: "he started up the engine and the car moved forward" Similar aheadforwardsonwardsonwardonfurther
   • ▪ in or toward the bow or nose of a ship or aircraft.
   • ▪ in the normal order or sequence: "the number was the same backward as forward"
   • 2. onward so as to make progress; toward a successful conclusion: "there's no way forward for the relationship" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ into a position of prominence or notice: "he is pushing forward a political ally" Similar toward the frontfrontwardsoutforthinto viewinto the openinto public noticeinto prominence
   • 3. toward the future; ahead in time: "from that day forward, the assembly was at odds with us" Similar onwardonwardsonforthforwardsfor everinto eternityuntil now
   • ▪ to an earlier time: "the special issue has been moved forward to winter"

   adjective

   • 1. directed or facing toward the front or the direction that one is facing or traveling: "forward flight" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ positioned near the enemy lines: "troops moved to the forward areas" Similar frontadvanceforemostheadleadingfrontalOpposite rear
   • ▪ situated in or toward the bow or nose of a ship or aircraft: "the forward cargo doors"
   • ▪ (of a voltage applied to a semiconductor junction) in the direction which allows significant current to flow.
   • 2. relating to or concerned with the future: "a twelve-month forward forecast" Similar futureforward-lookingfor the futureprospective
   • 3. moving or tending onward to a successful conclusion: "the decision is a forward step"
   • ▪ developing or acting earlier than expected or required; advanced or precocious: "an alarmingly forward yet painfully vulnerable child" Similar advancedwell advancedearlyprematureprecociousOpposite late
   • 4. (of a person) bold or familiar in manner, especially in a presumptuous way: "I am not usually a forward sort of person" Similar boldbrazenbrazen-facedbarefacedbrashshamelessimmodestaudaciousdaringpresumptuouspresumingassumingfamiliaroverfamiliarirreverentover-assertiveoverconfidentoverweeningaggressivethrustingpertimpudentimpertinentcheekyinsolentunabashedinformal:brass-neckedcockyfreshOpposite shy

   noun

   • 1. an attacking player in basketball, hockey, or other sports.
   • ▪ an offensive or defensive lineman.
   • 2. short for forward contract

   verb

   • 1. send (a letter or email) on to a further destination: "my emails were forwarded to a friend" Similar send onredirectreaddresspass onpost on
   • ▪ hand over or send (an official document): "their final report was forwarded to the Commanding Officer"
   • ▪ dispatch or send (a document or goods): "we will forward the parcels to you anywhere in the world" Similar senddispatchtransmitcarryconveydeliverremitmailshipfreightpost
   • 2. help to advance (something); promote: "the scientists are forwarding the development of biotechnology" Similar advancefurtherhastenhurry alongexpediteacceleratespeed upstep upaidassisthelpfosterencouragecontribute topromotefavorsupportbackgive backing tofacilitate

   Word Origin Old Englishforweard (in the sense ‘towards the future’, as in from this day forward), variant of forthweard (see forth, -ward).

   Derivatives

   • 1. forwardly adverb

   Scrabble Points: 14

   • F

     4

   • O

     1

   • R

     1

   • W

     4

   • A

     1

   • R

     1

   • D

     2

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. www.merriam-webster.com › dictionary › forwardForward Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › forward

   • Cached

   Jul 1, 2012 · The meaning of FORWARD is near, being at, or belonging to the forepart. How to use forward in a sentence. Synonym Discussion of Forward.

3. dictionary.cambridge.org › dictionary › englishFORWARD | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   FORWARD definition: 1. towards the direction that is in front of you: 2. towards the goal or area that is defended by…. Learn more.

4. www.dictionary.com › browse › forwardFORWARD Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › forward

   • Cached

   Forward definition: toward or at a place, point, or time in advance; onward; ahead. See examples of FORWARD used in a sentence.

5. www.collinsdictionary.com › dictionary › englishFORWARD definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   forward applies to any movement toward what is or is conceived to be the front or a goal: to face forward; to move forward in the aisles. onward applies to any movement in continuance of a course: to march onward toward a goal.

6. www.vocabulary.com › dictionary › forwardForward - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › forward

   Forward is the direction ahead of you, or toward the front of something. It can also be a position on a basketball, soccer, or hockey team. Forward can be a direction of either space or time, and also implies progress.

7. dictionary.cambridge.org › us › dictionaryFORWARD | definition in the Cambridge English Dictionary

   dictionary.cambridge.org › us › dictionary

   • Cached

   FORWARD meaning: 1. towards the direction that is in front of you: 2. towards the goal or area that is defended by…. Learn more.

8. www.thefreedictionary.com › forwardForward - definition of forward by The Free Dictionary

   www.thefreedictionary.com › forward

   • Cached

   a. Being ahead of current economic, political, or technological trends; progressive: a forward concept. b. Deviating radically from convention or tradition; extreme. 5. Exceptionally advanced; precocious. 6. Of, relating to, or done in preparation for the future: a rise in the forward price of corn. adv. or for·wards (-wərdz) 1.